*IsWdbtldK@/BTSYtCøЏ   xЏ   8Џ ht \P| HO( T _\ 0Oy C N Ol p6 dA O_ <) 04    4̟< 4  (0  0Ȍ6kp Q Ȍkpl<>   @<+Q4+Q,;Qq0S+Q Q*A X*, L* @* D*00   0 * $* < 80\ T   @@LHTDwFs tl hi*\fdPnQ`004u`0`2S`i00d`OMY ןt@ ( @8    2 D DP PPpPWAKEv`^| & ' ' '     h  h t , $       U  1          J  U  3   P %  $ $ $ $ $  1 @40D D@@!00000000P4 H4,D@@l4 h40!@P`p3Q pP 4 40# #  !`p4Q pP+.   0@### @0## # ####  Q00P   1000/    P/**/>?  @0123456789ABCDEFSTKP??@MTSTMBK2ENDMPRE$PST$PREZPSTZFLSHUNDFSWI PABTDABTIRQ FIQNUSDDRAM ERRORWKUPSKWUddedeTTrUTEEr 000040Q40pCCJJrCq EE`IIECECbtld4d@l@h@`@@BCRD-T P16D1@T 815&151@Π 0 9 Q00 +;00>ˠ 00 01P0@L  01 PP05800 ;+1600E-鐠 P\*|0k `pK@ \, 01. 01ƌ\:(00 ;+160-4 (000 $&0D- MⰠ P*5'50$5 @ 5 5|0P5 5 55 K5 5@0 5805005(05 Ѝ0D- 0D-T @T4<04404,04T404D-0 '\hFh@H$HDB24414141414DU iU 814V/14T >0T !114V V d14>0T 00T D1@1<14)T,14 1114>0T8S 00000V40040J4|0G4t0D4P  $(,048<@DHLPTX\D-8 400 000 0A4 28 `d0D-\ PP0000S040@,00 B~0000Thl-\ X0T0 0R000$00  00phl-MI280020`3c12c R*I0`3c12c#00lS0000S:ЍD- @P0,~0p`3 P P 0@SP@!  P ~0@ST 0D@p3 n3l300 P f3 d3(000S]3 0@UtxE- @` R1 0Pp0\0;R00S \$\\"R R Rp "R0  1\R \ R01T0;S00|O-AMH P`VI,100P? =}@P3 }p@0 3 33@a  }A/010 0S@> 1/1/ |10 t10 Pl10 @IL10 D10 "(0S W0000 10/ P P 00 W00R00S <00000/ ЍLPT`X\`dhlptx@DH|t-PD-Ԡ P 0j/000S0& 0$ 1 R00S  6 R00S R0  3 R00S  2 R00S R0  00;/D-0M` @`pP10 PD1 [yPT (1 *p%7P P$p 0P000S 0/&T 0p000S 0.W @ !G)G`0P.. @ /. .,0.0Ѝ0D- 000@0.00T31.0.0/0/0. 0.t0.h0. P\0.$@L0.@0.0D D-餠 00 @P0 {/|000Sp0 l000< T00P0#02S @0_.40000 0 $(,0p0D-̠ PP0  H/@000S 09.000 0S H=P3@?6C#::T  0.H0_.<0.400@,00P0<48<t@DHO-M̤  p P`\40 00*P0 [ t4@--'*PwD4  04  00 000' 00[ 3@--)P3- %*0 S 3@---x3-0 `3-  0S @ 0@3-P3t2-@PUB\00[ X @ *@\  w8#8 2j- -t2d--d2_-?00@U00S @X0  P@` & P `@PfU1>-[( 0100 Nj@1l-1Th-T0T& 11 1]-t1Y-h1U-`1-90#P0 100`@T!1R@T  00 `00 P00 @0,0 0ab@ 00,   0 [Ѝ8LPTX\`dhlptx|lG-Mࠟ pPak0,,0,00 0S 0,G0,@Pd0,,T0,D0,  0oЍ<@0D-$ P@P1f,d,0a,0^,0(0 0T,R,0O,(0 0I,G,0D,(0 t0>,<,l09,d06, zH0 cvP000-0D-M$ @PCp0PP0 , ,0,1 -`P*  -@P# 0++0+0),0%,@(00 0P0 vP80C-,0+Ѝp0D- P0@PP0++00++p0+l0@h0+\0 +P0$+ 0$!P0(0+0 lD-4 000(00 P0z+,lp0D-鼠 @P0' p,P000S0 e,@l000Sd0W+\0+P0+D00 P0(0D+0 $(,0l0D-Ƞ @P0* 5,P000S 0&+$+0  $,@`000S\0+T0P+H0L+w P0(0+048(<@0D-p @Pd1  +PL100S <1*0,1 uP@8 1 uP@0  i R00S  n R00S  t R00S R 0 tP 0000#1|  A h0 tP50@ @D0*80*0DHLP0TlX\`pD-鰡 @P1 +P100S1  +``100S T1r*pH1n*@1*41*$1 tP`p1 tP`p i R00S  n R00S  t R00S R 0 rtP5`px0 itP `00 PH0&*p`pLdHhlptLPX0Tx0D-餠 @0S P0 =tPP +@@U P06*D00@080.*O0@ 0)O0X|0D-ؠ @P0 1 *P000S 0)0 i R00S  d R00S R H0 sP@  0)0HG-餡 pP10 P1Q@P p1))`1) `@=H1 sPY017 ,1z)L = y*`100S 0j)h)0e)0)W a*000S 0R)P)l0M)0)VYh0C)X% 7 D-h @P\10 $*PD100S 41) *`100S 0)  *p000S0P0( (0(R P 0#)0)t0), ZL0(D0@00 )謾pO-锡 @PP1!p00=S.S -S T10P 0@! 041  )`100S 1(T )T  )pT )T |)0(t0 (h0(\0 (P0(+(  0D0D-阠 P0  G)x000S h08(0 *X000A$ZZDF<0i(40e((0a(04 D-ࠟ @ T# KT nT KTT K T T K T T9<T T h0'`0'X0'L0*(@00'00!($00$@p $t@-QJ@P @?: 00?@D-( 00 0'(D-(  00 0'ܸ(D-` P (D0040 0S000000'蜸,D-( 00 R0{'$0- 00 -4-0D-M⌠ @P |0 qT ^(T W(T  P( 07Ѝ0訷40@-{@P q0--D-锠 P +(P  l00 d00 \00  B <00 400 ,00  00 0x-XD- 0&8- 00Pص<- 0 000ᤵ<- 0 0S0C0t<G-䡟 P@P1- 'p100S1" '100S1  '``100S\1 U  ',100S (1&1&1 &1&0&0&X X #X  `Fv00`Fv `Fv00`Fv `Fv00`Fv<0&@@DHLPTX\`dhG-\Mt QV  ':000C 0 `pPX  '`0`U-   PX00U00S@e@   zp`0 Sp`PW .` 0B_S000PpW00U00S@u   Xp`e` 000C0 0C0 %X\Ѝl0@-PP &@@ &0D- @00 0S 0000004 5+P*218 8C8 T0 00@c28@I28 28 270 270 B 270 B 280 28H`pt-\D- 0}%xpD-X @P`D0 %80%,0% 0%p|G-P P@P<2- U&p$200S2" J&100S1  ?&`100S1 U  2&100S 1#%1%1 Y%t1U%h1Q%\1M%X X >X( ;P @`Fv 0R P@P`FvP @`Fv 0R kP@P`FvP @`Fv 0R WP@P`Fv<0%x@LP`dh-D-h d0$ X0$P0L00'@0$ B40$(0$جt- + @ @%@ 0D-儠 48<0ca48<0"c#b!!#c 2a3c113a @-@`1'0000[:PY)VK[\ p ` e`'$0S PUM@50Pd0PK'A@00ЍdhDHlptxO-M PRK11100U<*100fKkl 0 q 10SW(:0W%*t1v@`  V `VPU 16J0T000Y:P['fKklp@``V@PPd0/@@,0#Ѝ蜃|DHlxD- 1P10S 0`pA0P1S0P00S 0`A00P1Sp0h00P P H0D0040l^^(pE-x `p100S@\10S L1pQ dP% @1S @10S 1pQcP @1S0TR0O000S00E0@0@0=P|00 p00 !d00  BX00 L0(,0%^^(DHpTD-鰠 00 R000@0S8c0Dd^d00 0SSDP<0 0 $0'0G\~(E-t l000S @0TH00p`101PecP@T}D-h `000S 0P<00101(@0P1 R}O-M  2@0S P1q11 10 00x `1000@CTh1p0! Q(0X *40``@DTV10 10a`00 0000E C0@ b bP b  b00 0$0( `00 0SSL0000h7C40000h$0Ѝ|ptldpE-L p@100S41 @ 1000T10P`bPp@TW00@0000T0P10$L@00TH08000 00C08zD-D @0p`Pf@TPUxE-p Pd2p`2`2p\2`X2H2<2P/(2o$2y0v2s2p1@ 1P10!`0C011111;@Pp1d1{(%8"S0H! 0@1p41l(1+)1& 00 R 0` 0S0S 00S000S0 X0Sp0008 ~lx^^DHpT ( $O-M⠠ p ` `FP000Ut0h00AT0#03T030"S ` ](ZP0UЍ|uDHD-鬠 00 0S 0000 I"'6 9?060"'6 9030<000S 0t`(D-x t00 0S d0000 27# <000S 0\s`(D-D @000SS 000`s,D-H D000S8#8S 000js0D-t p000S S T00 8#881400 0 000Frl4D-p @h000S S L000A 800 0@$000$rl8D-造 @Ul000S S  L000 4000$000ql<D-| t000S S T00 8#880 0000 000pl@-0 2000  0Tp-$ 000!pl- 000ol- 000ol- 000ol- 000PolD-p I$/p`10 PUP1000 27`UUp !0S  !0S  00(P 0S  @@06=UU  0  x0 x000SP00 0S@0000UUcP o`04DH-d \00SD : 000 0 0L0m8pD- 0@`PPT+ P" R:00e\ : 00@ 0 00L0 P 0&R00S P`P0@ @TT 00(0Tppm8LPP@ : 0R00p@-`P0Sp(  0Sp(-P0$D-\ @PS $0T$@(00 0  ^dklD- P`P@$00aR|(000U00S ph0   2pL0U @P(0KTjTX\E-Ġ pP* 0 0`Q$0P@@T @?00@T00S  P@0 }P0P@TWj`-PN0D-锠 P@ T t0l0\00P8080 0<0 000@0$idhlptP0D-\ @PS $0T$@(00 0  ]Xhl0@-@P0PP0G-젟 p@ `PT 0V0SQ0NPVt0Ft0C <0X00000 P p q]gxhlp|pD-鼠 @`Pp]YP]:]P`00l0 A]PV 0BpR8pPpV p,pfO-MM  P``YT P2 pP2 20S 0Sl2 \2X2P2D2@2jU  `00S P 0V [[* `00S P 01 1t1VJ 00S  P?PU%* ;@P8#8S 0]0X 0 @P PU:00 t0 r\P\0P02ЍۍelpD-` `\PP00 0 SZbUp00@(00 K\000pbD-( $0**]\ 00 bO-M4 p(2 20p2p220  p10 1 10 1 `1P0P 100 Rڔ100`p/0S$X10 0H1 10 410 (1@0s1 11 00 0 00 Hfu00X00S00X0S X00q0n0kpt0f(00 ЍaDHLE-ؠ @0 00@TP@-000S PP|0`p0p0St t T0SP@,_0D-Ġ P0@P0P0S 00S 00S0d@0S `000P00 00 000S 0 0<^LDH D-D `P81p0S(10 `Q i R00S  d R00S  e R00S R 0 ZP 00 0080<0 H[@:[@\0L0D0,0aL] (l$(,O-M M⤥  4`pXYP@t50 00h5\5tL5I H5$$[7;0Q00 4 6R [7;0Q 00047424- 4(4#4Yt4TX00Y00S L4 0 JZ04X $4@Pdmi3@'T30 0S 30 pW 3` PDgH3O3J3 Zx3 @@h33[ P+!Z430 @,3  30 `3T-Z[2K @2K:00 n2K @L2 20  (20wt2h2}X2H282(22 2 11 ET@1J  Y01C&10 P@1Y[K 0 P1 0 00:#:00@41ˠ @1""* 01FT0 0  Ѝڍ[048<@DHLPTX\`dhlptx|tO-MM• P`t20 pl20 d20 \20 00P20 0 0D20 00P 02 XP0@00PE20 @P11e110S @1 Y YXW0S[ 0S7 @T1XWD1X@41XX1X@ 1X[0X@0XQ0X@0X Q0X0X01P !x00 0` `0$ 0ЍۍTU l D-H D00 "(00000'|R$D-̠ @`0 00 pWT0 (XP 0)  `0 XPQ AA5S  R$0R(,048O-MM@ `pP02  200S 2  100S 1 n10 10 10 10 0010 0010 PU @1 X XYX0S[0S7 @H1WX81W@(1WY1W@1W[0W@0WQ0W@0WQ0W0W01`010F   X   Ѝۍ Q<@D 4O-MD P` p00P  pU  00 100S 0S0S1 K)G-0SI @ @<0^-"0h1  0L10 D1W@P101 $10 _0  10 10 @  o0 0S6 0 00 00 0S ~ P  Z0 00  B00 |0  l0 UPE ``00L0 0ЍNHLPTXx\pt`TdO-MMآ `20   TP@200S 0S0S|2_ (@,0S @,/@2 O;P$2+ 2E 2 ;P WQ . R00S R@10 @1) ' 1$  n;P1X Qx10 +V@K P1VpP/<1 41@ 1 10 P10 0 100 p%RV ,7;P  1;@@00 @ 0 0 p:,(0 `00p0  0RЍۍKhHLlptx|TTx\ptd- `- \ 0) 0  \ D-锠 00 S  X0 T0 P0L0H0D0@0<0q 00m XHtD-X ʠ!H0@4   "0Q01PGpD-Ԡ ``00S 0 00000#0@0P0PT@DT T00S L0 000 ,0 0000`p GttttE-鸠 P@`p  @@ @T x 00p000@T@H000T 40P 0p@0T (FtG-蠟 P@p`  @@ @Tʨ0礀 0F4#01d#000@T@l000TP0P0p 0F4#01d#@0TF} { XEtO-M PpP30P30P30P30PU659*=#0 3P 3 3P3P3P3@F`GP`3 `30SPT30S U U10000S,3H #000S"20@ F P  20F 20 200S 2N l2U,p0Sh2  [k 420S42@FP  20F 10 100S 1 1CU"A0S p10 0Sx1@FP  T10F <10 110Sk |P00S  U000 0 0   0 0 \@0 l0 `0 ЍPDttttttD-` X0T0 L0 H00@0<0$01Q?X\`D-d \@ X00S000S004(0 0R 0 000P?\X-t p00S` 0@0SP000@0@  S0 00>`X\-圠 00S0 00Rd000\  S00@0 <00R400 008>`\XD-P L00@Dp<`@0P0T@0T0@x=\X @-P`pQ 0R 00C R000Q 0 @bT DR0p000@Tv@T@0p000K-MPp`(,0@At  0@DtЍO-M̥ `0 00P9 P PR U+ U[PP A0@S  P  0CP0H00 02P P  P= P 0( P_ P P'  Pm P P )P+ P P P UP 4PS  00C 0 R* 00 0S  00C@ 0T*@ 0T:@0T* @0T:@0T*@0T:00 PY*@`@T  R  @DtR RB*@ @0T: @D 0R(z @D 0R 0S o 00C 0S R *@ c@0T: @D 0RX @D 0R 0 P 0@`0@ 0 QD h ><@Dt00C0PP?pP* 0S $ 00C 0S R*@ @0T: @D 0R  @D 0R 00QQ P*@` 0 0`00  0JL0 000S!S 0 0 Ѝ;\`0D-M8 @,P0Sr00 sЍ05hD- M$ pai100S1:0P0< 0@ 0"@000 0000 0C0$000 0$ p0 Y@d0T <00 Ѝ|5(l $(,0O-MM, p`$0`30 ` 30 P30 0020 20 0020 0 020 @W  00pG20 00[2QO2Lt2HFd2CAH2> 0S $@42P PUV YR0S7 $@1PV1P$@1PU1P$@1PQ1P$@|1PYd1P$@T1~PQ81xP$01tP$ 0S!p01 10 `$000000 0C00P0 0 0$ A X@0A0<0 000x0$ 0E$Ѝۍ4|48<@DHLPT(lX\`dG- Mp p`1P@P1@1T01 1($1000 0C0000 000@001S 0`P1 Pq@1SW0V|0QOl0L  SP0$0A Ѝ|0hlpt`(lx|D- M℠ JP t0&l0#d0 $00L0000 0C04000 00 X Ѝ.th`(lD- M蠟 pP000%$000000 0C0000 00@001S t0`P1 Pq@1SW80 S Ѝ.th`(l|0D- M┠ P@P x0h0$00P0000 0C08000 00 W Ѝ0-t`(lpD- M┠ @`PP x0h0$00P0000 0C08000 00  W ЍpH,t`(lG- @pzP`P0T R0O0F0V0D0}T0|08 xNd01Q* 0SQ:40a+`-̠ 0 1R@QQ 0Aq Aq  R  RQd*l0 4 8 <D-MР Pp@`0 .@`;#;`S0 8#8`Sx0 D?@0S T000D0880<8 PЍ\)0D-l P@080w!L00 0D00$040 80A@P000h(-@ D-ؠ @`Pp  0S kA@P 00YW0T  b8j@80pc@0Sg<8P 40~,0<zB'-< 40 1RQ&lD-Mؠ `p@ {PD RMP@0S D@P|08>h09`05T0<1 @@40(<TЍ|&D- @P0@00T(`0P @T(0 LP  ? R00S RPPT0@P00T(Dp<0`FMP @T(% E-x `Ph0\0PX00U(LD0p @lMP }PU(p$pD-\ PT0@P00T *@0`MP0Sp@T:p#E-x pl0@h00T*X0`PU LPLP@T:d#pD-\ `T0@P00T *@0P0S LPp@T:p"pD-騡 `P@1 ? R00S R 1h1 6LP  ? R00S R (1 &LP1 V@Ti@P 0S,  0 ap0|0 @Pd0T0 @@00 000`p`"  (0 (0(0 8 Q Q Q( 0 0( L40(0( 00( 0C 0,,(1S( 0(0( 0-1S E- @`PpRp0  0 \pW U PEVP LpU00SP@ P@T P00@H00 X00R00S$0ZX@$(,D- 0 0X0D- 0  (0O-M@ @P0pRpI2810Ibh pW 00h S UP p  P@ P@T \00@T00 Q00R00S,00S@Ѝ$(,D- 0  0p@-`@PRp0SpPUp0SpD-Mⴠ `PpQ% 000S &KP1! @ "d0 K0 /00B0 00B   Ѝ40@-P@J 0@-@-$0S- 0SD- 00D- 00 D-MX P000S 00400  00ЍtD- 00D-  00 eD-$  00 9D- 00lD-  00 -@0D- M8 P @   0 Ѝ080D- Mh P @  H0 80  x 0 Ѝ0<@8@- M @  f Ѝ@- M! @  Z v Ѝ@-M @  O kЍ@-M @  aЍ0@-M0P  J@P* 4@T: LЍ0pD-M☠  Q00000C0 pPp0@110B` 00B Q\L 00S0\00Ѝp,DD-x `pP1@C`0000ST0 0R 00W4000@D R00|DHD-ࠟ  @00 R+ Q0R@# Q00S xR oR 00B0 S a0BSW0BA0BS70B00S<,0(  0 R E-鐠 p0`00V*t0@_IP fIP0S`V:,00LPTX0D-鈠 P@|0l0`00X00 80<0 @0R 000H\`(lptldO-M` P2[H20@20 80@<0@`p 2R#2H 2 1011y10 00P0U  P0U@TX*0SU SS T* R 0S @T* R 0S 0S T*0 S @T*0 S@) PT*0S / 0 S S0 S S@ 0aS00T*0S00 Pl0 \0[  T*0S Sۍd(lptldhlptXpD-\ P@L0`P <0 GPQ` U`px|-pD-阠 00`0|0x0Pl0`000eC1@BDHA@0 GplLPE- `PpQ0pHP0[Y0VT0Q0S U @P G @  ; 0S@-@gG-M℠ pt00@@P  uGl@@ nG 0W00 ۍO-M p1 110X9*000PWP @T`yGPP@TU 00S :S x0  w\0H0 +80 X:Ѝ LP-0S 0S 0S 6GP 0S 0S   0RO-M8M✢ @8p 2P200` )Fd20 101 F pT" - R00 S  n R00 S @R110111110UC*8 H8@0@DP4 01t1FF\1F0S :S81F QF1  0F  F0FP`00U:[00P@P F(00 80P08Ѝٍ LlPX0D-| 0@ h00Q X00S0 40@(00S 0( pD-С 10Sec 1Pp1 1 1p@20|!0t1p1\0P! 00Q,1p4!000 10  100Rp +P0  000Q 0@0T`0P@|00T l0x00\ T0@   (0 p@<0l00pttttt218 18"18 B "1Cr1 00218 O-Ƞ p@`PRsP$ 0U!810 Y `Fv めR10008P0 P0U 810 Y `FvTPD-M| 00?P 270 P0    @0T 0S@0TЍ<0D-t PKOP0!(@Dt 0 1808R1P018 0-$ 00 0SS$D-, @P 0oM@E-鴠 I4?`P0p眀0A0 0P 0St00S0 0 0S 0 0 0400S P U0D-DMȠ P0+(P $0#180@00  0S @T HPD 0@S @0T 0DЍ0 @-`pPkPEC@T>00P@T6- 0- 0`- 08- 0D-( 001!1 pD-@MĠ P00 0S( 0000" !00` @ :D t0D P PU T0o3Dj40f0@Ѝp` D-  P# @  ^\Q80  ,0   270 I4 - 0- 10 0S0000 P# ̌@ˌʌ ̌ʌ\Q8 00, 0 000 I4 `- 0dD-\ PR ")1H9CQI$y-2>>I$y-2>>70QI$1:I$1:QI$1:I$1:QI$1<I$1<QI$1<I$1<1QI$y-20I$y-20QI$y-20I$y-202I4<@$I4y=(0I400I4. D-鴠 P P P 00x0x0d0h0P04000S  06X_p__(,-BD- 0%0-B@-@`B--O- MĠ `0S' 000 0 僱p@ 00cXW4 , fN!("(%T @TX` 0 S ЍTJK-Mp0PR$ 8#hH$H+ 1 0! + PUP Ux$ 8#hH$H'     P UЍD-T P<0@ 0SS0PPO-MT 0D040p4?0 0S(? ?0 0S S ?000 >p>00S>h 0X O?0R O?0L,@ O?0F O?0@`>tv 0/L>n 0)bDjD0S> l1&@P =e== n&P=l 0 =n 0@@` 0,P0@`0 S S S S S 0 S S S S S0 S SG 0S 000 S0 S ,P0 S S S S S 0 S S S S S0 S$ 0S 000 S S0 S S (P0 S S S S S 0 S S S S S0 SP~0S~ 000 S S0 S S $P0 S S S S S 0 S S S S S0 S S#000 S S0 S S 0S S S  S S S S S 0 S S S S S00S000WQ @P&Y$/ B`,0|0(x$ t X: zL:97<:4|2,:/x-:*t( :%00S 9 [@ T*eoP2 @,Pn 0@ T:p90 0!U0b8#h] b("X  0GK@ P3   0>09(W00T00SpGT0 Sp1:T8 \008n 08n 00 0dm 0_R`8pL8`@8@R@ N@800S( 8n 0:@70HS?ROY@7 ?2 *@e?0C c7x7n 0\ - R00S pRpWl @ $P7n >;Cl00`P/1`P0 A0 Sa0ASWAA0AS7A?=2/2E ^030^P.P0 S0 S 46+@P0 S S S 0 S S S005 5 ?P@ ,?P@0S5h5@ A$Pp5n >;W H5n 0 / @1 0R@T8pl5 >P4n 08 R @'@P@0804  t4 8P <`4n 0<P<4  .>S0 0S/ `P03n 0:P[K 0kU*@eTG0 PP000>;0L \ 0U:m 0t2n 0 @@\K 0: T0*yp8 R H,PQ0H PdUY# 0 `P@ U000~>0L \ 0f T:m 0d1n 0@@\K 0 T*+ 100 `d 0Vk# 08 RN 4 04[D4`8<@DHLPTX\`dhlptx|u\w\v  $(,0v4PU*pp000000 0RTPU:@ /00~>0L \ 0 T}:0F 080S 1 x$14t01p14P4m 0`1n 06t1*x1\1%1@,{=1 U==@ 1D1@1<1 711m 0 n >;(2n 0<2n 0PR2@ T[ tx2 =P ߍD-鐠 @0K26 "&00000027 4000S 008<0D-4 P(2d 270 I27 $ 1 ( 1 R10,10 10 1 =700 26(0 26$0 26 0 BF000$X1^+000@1W$4100S 1II27 27 0> 260 t BF0n0 j0$f0(b0^\000S 80-0@`{DHLP<TX\`dhlD-@ 40̠0@ 0 81QD0D-̠ P00S00L00 @0U00Oll0P00Sڞ /"b1P0P,00Dptxgfff|D-@ RR$0000D-P @PD00$ <0 PP000X`{G-h p\10ST10H10 810S010l$10 `@PP0WWSKˠ%~>2 !b12c 1` #000  020@\ WKˠ Kˠ00E\Kˠ\ 00\}DAݳ D- 0Pod\{D-鄠 |00Sp00 0S`0000P D000S (0 08\{`<D-Md 000C0L00 0S <0000P00  Ѝ`pD-锠 `P00S00Lt00 @U}]d0X0T0H0KO@0Sp`D0SpD- M00+ = Ѝ-+ =wC-M`@pP $0S3 S \sB s WRd h0`L1>d h0g(1 5Rd h0`0"d h0g0"0[U0d020e02 U d h0aL0 0 d h0e 0 0.ЍQQ!Q1D-Mp d00 0S T0000 @0 R <0R00 0Ѝ(`\{O-M⼠ 00 0S# 0000 p @h(0X &%('@ T:p W:Ѝ`E-鼠  !("x8#h00 0S0000PP(@X*/ ("(("(08#HT:08#XU(`-8 400S(00 00 D D-MP  0<00 0S ,0000 R Ѝ`D-MԠ @0?00 0S( 0000"00 P 00  t0 G<0,P X0[P0W800 0Ѝ$`D-造 `pPP @V00P00S  P00@PN-D- 00|D-< P000 TpD-d @PP `T p 0pD-d @PdpP `T p 0O- Mؠ P0y0v) w r  mp h` cP ^@ YP@  0 ЍE-M┠ P0= ?p :`  5P 0@ + 09ЍD-x pPl0 ` P  @ 0 tD-锠 pP0 ` P  @ h&hX%XH$H8#8 !D-M` @Mp_`H100@Ѝ000C00 18 -PP 1(0@s   7`00S0Ѝ00+PP P0@s  7,-U l0P X0 @H0{800 0Ѝ<pD-젟 P01 d`9P0p0`P0@}zwtqU(0.p\pD-0 P00 00 D- MԠ @T00 @T0@P00 P0$000000 0C0t000 00`0  @PH080 ЍL(l --崠 P P P 00  0I4y= 0 I$y-( I4y=$0 000 $00 00!0 8\{D-Ƞ  !Ƞ("000S!00000 20 00X000S0`8#=l8!##(!#$0000.$ h\{H-嬠  !Ƞ000S !0002 X000S0`8#=l8!##(!#$00000\{H@-@@T6P-0 S S 0 S SpD- P@0 N0 1R1P p`0Π` R.$ 0 0S>" 0 0S.  Pp(pFpD- P@0 0 1R1Q p`0` R.$ 00S>" 00S.  Qp(FG- M$ pP ` @  5P00 1 5P10 1 5P10100\0MP0#SRP `005P @@  o,100S31P `005P @@  X000S0P0#SP `00h5P @@  ;`\000S P0,P ` Ѝ $(,pD-M P@`0J0F0B RP0"05010 -|0)0S 0S  K800 0^Ѝpd048<@DHL?@`?P@O-Mx @P!Fd;,4`TTTT{PQ%!!00"S*! 10 ! $10(! ,100! 4108! <10@! D10H! L10P! T10X! \10`! d10h! l10p! t10x! |10! 10! 10! 1|0!x 1t0!p 1l0!h 1d0!` 1\0!X 1T0!P 1L0!H 1D0!@ 1<0!8 140!0 1,0!( 1$0! 10! 10" 2 0" 20" 0/1 !@ Q q0 00"0 0㜋 0 00"0 0cz 0 00 "0 0㇇0 00$"0 0c0 00("0 0㜋 0 00,"0 0cz 0 000"0 0㇇0 004R0 0c0 008"0 0㜋 0 00<"0 0cz 0 00@"0 0㇇0 00D"0 0c0 00H0 0㜋 0 00L"0 0cz 0 00P 0 0㇇0 00TB0 0c0 00"0 0㝋0  000"0 0{ 0 00D"0 0c 0 00"0 0c0  00,"0 0㝋0  00@"0 0{ 0 000 0c 0 00("0 0c0  00<"0 0㝋0  00 0 0{ 0 00$"0 0c 0 008"0 0c0  00L"0 0㝋0  00 "0 0{ 0 000 0c 0 000| 0c0+0#0,"0x 0c 0)0#08"0t 0z 0' 0#0D"0p 0c0( 0#0 0l 0㴈0+0#0"0h 0c 0)0#0("0d 0z 0' 0#00` 0c0( 0#0@"0\ 0㴈0+0#0L"0X 0c 0)0#0"0T 0z 0' 0#0$"0P 0c0( 0#00"0L 0㴈0+0#0<"0H 0c 0)0#00D 0z 0' 0#00@ 0c0( 0#0 "0< 0㴈000(0"08 0c000+004 0c{ 000)0 00 0㈇ 000'0,"0, 0㵈000(00( 0c000+0$"0$ 0c{ 000)0@"0 0㈇ 000'0"0 0㵈000(08"0 0c000+00 0c{ 000)00"0 0㈇ 000'0L"0 0㵈000(0("0 0c000+0D"0 0c{ 000)0 "0 0㈇ 000'0<"0"0㵈1 !1!p000!"S:1  pߍP#EgܺvT2@-p@ `P 8200P10N@p@-@P` pp@-`P@10C@TPUpD-X T00 P <00 400 (00 $ 00 ̸T\pxt0D-< 800 0S0 R@ 0@@0P<XO-X L300p #2C@P 13 1`V32! 01@V21212$ -211  #211h21(0T21`V<2@1 112120 11l1NU3A80010C0: 000Eo1>3A8 001 G11ah1p+CAH@PPD10 001 0`,10 0S @P10 0023 0`00 0S 00P0 0@0 3A80000 00 0 0`000|0 l0\`dhlptx|<\xt 270000 270000-h 0`  0P PP,0(0$0 00 H___D-Mࠟ @0 0 P L0000 p0P "t000S 0ST0f %<0"40,0Ѝ\H@-M@00!!0SЍK-M`P00Pb00CS'$]"! ;0 P0S00: 0600@pP'@Y TT:00 0RY 0h @ 0T*0 @T: 0R 00ЍO-MM\ @40 0SCGP 4VT㖱4l3GEㇱ33X3Tp  PP P0S, @@`Q@$A 0;P0s S h;0C  0RT_+ B 00SQLQJQ@0S L=0 0 0 Q00R00S- 0C0C4@  P\UP00`8000`SVQA  .0@&0T SS ˰0,T R pPP p00 0S3UnVC 0S5 㫰$@@D P0yD@v<0sQߍۍ,D-鄠 @0S Pʠ!L<#  0,88# BR 0P蘫FD-T 0AS80 40 $"00#8#0ASFD-ࠟ @00S00000S 0 000S l0<\0PP0 80 T.7 0 蘪Fd{ 20 "0S!-0`cc0S r 0R r0R0S0@-@P0 P 0P0@0pD-鴡 10S| 100S 1p10h100S 0S  P ,1|1 <%0010 000S 0S   0db0_pP 0X0 ;<0C0t@000p0h0 @Tp4`PP@TpꨨFd{Hh{D-造 |00S p00S 0SL0 {-<000S 0 账Fd{D-( $00S 000Fd{D-4 @,0) 0 @ԥ h{ 000 O-X @qP  p P  $ 20 200S 11@020d02 02020|102h102T1`V2*( @ 0201P T 00210@000 0020 8#80 00020 `V:t0@P0 02 02@0H0<0pp{ $(,0pD-M `PA0S001 X,Ph1 O,P "100S 0Sl1EPX1 7,PUG81 .,P>1 %,P100S0 ,P000S 0000S l0 d0 +P@0ЍpԢF48H<@DHLPT-L D0010@0#$ @   001 ᜠX-, $001 01Q0?1K0?01D0?1>`10S@ 01>x140?d1.0?0L1'0?041 0;> 10;>010?0 0?000?00?00D 01>001>00PЍ< GGG  $(,0D-\ PT@0S800S 0$@/'0P0@ GE-p `P`20S 1>00S420?@p4#H \P10S 111~1z00p0 $4000@000 0@000 000 08Q000@(10S ,1Q001J! 1D@000<0005000. h@  0S000;00000;000 Rȏ GG048<@DHLPTGpD-Р `00@S p,DPpP100US0S l0pP@@P & 02V  &p GX\D-\ @T00SP400P 001>0 2( GD-\ @T00SP400P 001>0 2踋 GO-L `<10P2S~ 101>0P 10S 160 p0lB0g0 c 00^Y! 2 @`p[ P P*s@`h0G0@X* p@T:H GG`dh8lptE-餢 `P20S 1>00Sh201>0@<8p4#H \P,20S 222100p0 $4000@000 0@000 0000 0d 0 0 \10S41000; 1000; 00 000QP000@00S 0000! 0d@00|000d000L0ȉ GG048<GGx|HLPTO-L `<10P2Sc 101>0P 10S 10 U0QB0L0 H 00CY! 2 @`p[ P P*X@`h0,0@X* p@T:܆ GGdh8lptD-4 (1!! U\ GD-4 (1!!  G0D-` P @L00P <000, 02?001>0000Ą G`-D-0  @0@p@-@ }`  xP s p@-@M @ P @ @Ѝ0@-@ ]P  X,0pD-Mt @ J`  EP P =$0p Ѝp8p@-@ *`  %P %p0@-@ P  ,0pD-Mt @ `  P P $0( ЍpD- 0!0萁GD- 0!0XGD- 00 GD- 00GpD-\ P` @TD0` @ 0D(0`V0 p踀p@-`xP <@P\ # p0S a0BS 0B00S0@-@ R A0BS 0  \ P.00 R A0BS 0 @  \T@000D-Ԡ @000 0?0 L \03A\0-A/0000 L\ 00 L\ 00000@00(p@-M@Pd0S S (S %l40CR0  0 l40CR01!l` +#0020>000 #ЍpA-`P  0 440C0\0U030"S tpG  Pd0P0U030"SXP O-MD     0t <P<R1S$0$ 0$ 0@ @@` `Y1]<0 Sx1<UQ\1<40C R V:*0A #@10S1ř V U1*00S0 0\0 0P ` V `!P@ V U1:G P40CP V:$ B V0#03Q00S40^Ѝ|$G-M\ЍD-阠 `Pp40CQQ t00Sl09 @ P40CTT W0P<0PP20S\r4@ 2220S3 2,t2(h2 \2$P2 D282,2 222 11 0t`pdPpB᩽tP 00U *0 00PIPU:(10S X1Mt0h0P$l0 1S$0l`@T * 00P @T:00S 0$l@۫\00S x@  00l0@ǫ0@ЍHhP$GTX\`dhlptx|A-@P0` h0lpU *\ `0 P`0PU:0D-ܠ @PA 800P0 P  P0Px00\0@#P P0200040000tV0taD-M Mؠ P0@0S( @ U0t 0p @ @D gt0l0 Pj !1(0S 0b Ѝڍh`D-L  Y@40(00[0p_pD-锠 @ >`  9P 40S 0S 0S,0!p 00 0p_D-L P@ 00#0 00 0>\^$G0D-H @@0PA 82,0,@;V0]D-, (00@T2P]D-@Mp @d00P  0P `80$00  @ЍT]pD- Mx `@Pd00P  0P UP!1($000~ Ѝp\E-MM Pp@@DU. j10S1w@ !1(`100T`D @P' !1(000003000!R$ "`0000Atp @P06\00`tP@eB` @`\R@ `0 Ѝڍ4\$GG-MM℡ `P@@DU& L10SD1p [ 0G z@P 00 0*1S$0"`0Atp \@P|0tP@eB`p @`\R@ `0 ЍڍLZ$GE-DM⠠ p@P00P $` 0zPUP1D0@ 0 000NDЍX0D-锠 @P000S T p@P   h (0000T0W0D-锠 @Pc000S T C@P   ; (0k000'0@WD-@M⬠ P60` p  0@P A1H 0 "t80 t,0 02@ЍV@-M@d 00R R (R %l 000<0 R4 l0104040C R00C l0  0#20:#:0Ѝ 0D-鈠 @00S 0S dP0 0S@@0  0  000T H- 0T,HD- 0vS- 0 S,HD- 0SD- 0SD- 0 \SD- 04SD- 0 S 0D-錠 @|0.t0+l0(d00SXPP@ E0S 80$00RH $D-D <0 80@,0 R 00 ,R0H( HD-( $30S3 30S3 @P2 P2222222@2@2@2 2 2@2@ 2 g2@|2@x2@t2@ l2 h2@d2 `2  1 'L@Q`0000@DS0 'L@Q`0000@DS0'L@RQ`0000@DS0'L@bQ`0&000@DS0&10!0000 !00?1000'L@p@`P`0@DSte0@S'L@"10S "aPP@Th U"10S0' 0 Q,H,048<@DHLP(H HT[H0HH4H8H pD-M` B1@ L4./  44'( 4 P 4H0030 S=sS000!03BP@ .0X30S -p 0"!00 30Sp3220S/00S2'L@RQ`0000@DS0 S2'L@bQ`0 000@DSzv0 p 42k02i,20SS2'L@bQ`0 000@DS\V0 P1K1I1v0 0 00P P 00 P0PR1   0"2Pb1  02 0,1(1O  1H %0B00S00 0  05 0-P. 0000Ѝp= 01+ 7T T T 0000000 P000T  0T$ T+P  PT0P0XP1{DHfHD- F0P 0HD-鐠 0@T0p00X00QL0 0  C0Q, 00C0 00C0/HT[D-8 4 0000000S,/HD-8 4@0S(0yE00.HD- 00S.,H D- 0 T.D-̠ 00S0*@0@00 ;0 N000!28 28@T0I"(6:080000.H  - 0,-HD-  0-$- 280  280 280 0!Р!A-^D- 0P,(D-鐠 2@ 0C   l0 200(  D0 200 0, 2 ,,,04-D- 00S00t+H8<-删 0 |0 20q 2 ">10P:0 20* P C K2 8+@HE-ࠟ pptvP 2,0 NM@ bP/U ,0 2,0,(0 " <10P 240400@0I 2<0<80p 2$0U C  *D 2,0 2(0 D-M✠ p20 RP RPPZep0 `  @@ @0 40 k 0Ѝx)H@LP- 0(HD- 0(TQ 0 P:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!- 0 QaB! P`BP:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!\`B-Q) QP10QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!" l!-vQaB- -P`BP$:0QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!" l!\`B-A -L@Q T+0@D0 0 ! 0 !0 0 ! 0 !0 0 ! 0 !0 0 ! 1T #T 00 0!@T "OB -LOB p-LPPK`d8MD P L0 000 ,0 @ 8 @P@T<00SBTp p-L`@R 80S01RPPU pTp 0PSx1(P 0$0Sh1$0(  PpP0V P`f 0 00FSP $0S P ($P0 `& 0S80PP $0S P ($P R PPP 0S000  pH@I@ B -L@P 0S 0SXp0  R&A8AðAADAÐAA AàAA4AÀAAA0S0Cp0    0S   000 #20Sd 00000S 0C0 0P  `p0QP  00 00000S p0C0   0 <0 000S 0C0    0p80 000S 0C0    0p40 000S 0C0    000 00 0 00 0C0 pw 00 0C0CWpWV   0pS 002SBSBSBTB000S@ p0C0   0 <0 000S. 0C0    0p80 000S 0C0    0p40 000S 0C0    000 pR 8 00 0C0 00TB p-L@P  Rp0 S 00 0C0\p0`QP 0R Ra\  Q00Q0n 00 pTP` Q    0S000  0P`0p-TB -L@P P $0SP ($00 -L`@pPP 0S 0S  00P  0 04 3@C d`  00 -LP  R@@@@ 0S000   -L0  -LP P P -Lp`(@  @P(Z. PU$P($(  PU(P($$W0,08p 4P0P  <0 -L`PLML 4  P 00pR*0bC,0Pn0 S'APAAAAAhAAØAAZ L 0JpW@ 0 SE$ADAAAèpG@8pd00,K0K4 K80K`\ `,04 80P\  p0 l 00P0 40ꨁpG0ꨁpG0ꨁpG# 00 p0 l 00P Z L 0JpWD3((0R 0# 00 p0 l 00P0 40pR 0S000Z  pL 0 l 00P\C,P R 00( S P R*0bCP0c\1L P484 P 00L R*0bC,,0PnP R 00( S P R*0bCP0c\  pL 0 l 00PO L P@ \ T @! T @!  dP0\0P0 0 d0dS00S00#Z L 0Jp WI$I R@2P 00 p0 l 00P0 40 (  P  p0 l 00P TBTBôTB(pG0 0 0 #50R*Z L 0JpW⨁ pG0  #50R:0`0 P dB0P 0` 00` $0 @P L@ t( $ 00 pL 0 l 00P0400@0@20<0  QX@ T {*@W *Z_ L 0JpW:L1! @^80 pd00P^N 0W * ZG 0L0 0JpW:8pdp`X@1" , 080T0 QP00^Q ( $@ 00 p0 l 00P *4TBøYCTB^ 0T 1 0\@20<0  QX@ T :<0K   @ @ K< @DK H K` $  @P t( $ 00 p0 l 00P `<@D H0wP  p0 l 00P0 40( $ pL 0 l 00P040NL P L L \4  P 00pR*0bC,0Pn0S 00L P040M4P 00L ^0 40R pL 0 l 00P040z00 p0 l 00P j p0 l 00P0 40] pL 0 l 00PO pL 0 l 00P040B pL 0 l 00P4 pL 0 l 00P040' pL 0 l 00P pL 0 l 00P040  p0 l 00P 4 0-L@PR<0000CS( $0S 8(0\4000   <00 p-L@P0`0CS( $0St`` `8(0\4000   <0(($($$($p 0-L@P(=(0040000 -LP -LM hK0 `0  h0 d0 `0 \0 X0 T0 P0 L0 H0 D0 @0 <0 80 40 00 ,0 1 !1 0^00h0pSNd0 ,S! h KQ1S 1 S01\1 h K^ 1S 0q1 1 Wp!Qq p *h K1 \ JQ :hK 0 ! R ! Zd`K K^a qh`K0pK 0 q 1 ac q0^q  !Q!  !0p00^:0 p 0  ! `P ` h`K1 1 Jz  $  `RYh0Kp1  p$ 1gY! g $ 0P00(1 0@j 1 Q *c Q*0P( 0ZS} !\K!  0 !<D 0@1 `0B!> 0bQa!0!0`S<`gD1!S:?0@a0 S *S ` 0@P  `0b!P @ Q > Q0`JC*!1!00 Q:0 ..7$0C 0S $!0 B0Cpl0 70C$! !0Sz?P , !0RS -L PM`@,P (p P  ,0K00  pd@t0 WBt 0S0@0( $4WB -L p M`@0 , ( PN 0 0 00,K-PP0Su02 u1 0- 00@ @ PP < W00R0S u,0 u  0 UB$UBXWB|WBVBÔVBÜWBüWBu 0P0($WB -L((@$HCôHCøHCøXC -LPM, @0  400p`^*0nC,0n0 SlA8B,BàBxBB(B0BìBB3\ Y( p00 000 b004 00A, 0  400p^*0nC,0n,0S S 0000 0 W *Yi , 0 0IpW0 :"101 08pbS 00  00 00 @R  00P" 00 p00 fW *Y5 , 0 0IpW0 :1!000pa 800  W *Y! , 0 0IpW0 :l!101 08pb 00 00 B@ 0010;! 00 p00 W *Y , 0 0IpW0 : pa1 08 0( cZ*,0bZ:PB \3,^00( S ^*0nCYCWBXBn\, 4400, ^*0nC,,0n^ 00( S ^*0nCn\ 0, 0, LZ(00CS000\8,^ 00( S ^*0nCn\(, 4400, ^*0nC,,0n^ 00( S ^*0nCn\ p, 00l, 0L0WpG0  B0 , 4400, ^0 40R p, 00H00 p00 = p00 4 p, 00+ p, 00" p, 00 p, 00 p, 00 p00 00`0l 004  -Lp@P`(  P 00p@P` -L 0($ -L`p0P4 U@e,0@e0 T@!0d 0z00T0S 8\ <  <0 , PU$40(PS4P4 0@eT@!0d0z00T0 S  8\ <  <0 P 0P -LM` P4p0@, 00 W* 0gC,0g24 8 0`FT@T4, 01\I 05R@b0l05S@c{  @lT 1 05\0`FT@T80 0105S@c?  T a0( *0`FT@ T:@l 105\0c^*,0b ^:n Q l0\0(0Q0a00 A 0Q0W00 A 0Q0M@ 10 1fQ!AD0 a0 P@ 0 b000``4pG@ Y1 fQ!`<0AD0 P@ a`0 b004p,YC0XBHXB 10\XI0 5S@c l V00YP71 fQ!`AD P@ a`0 b004p -L0Q $M, c,0S^ |1,p,Wp!gW, CpGW0    L @P`L0  0 4 40 8 < @ D  H 0  8<0  @D0 H  W 0pW 0  ,0S  -L 0@S00 P -LL|  0R  -LR 0 R0 -LQ:R 0 R0R  B0R0 -L0R  R p-L`PV @T0PSp -L 0S B00 -L 0R R -L 00RR -L 00 -L0 S 0S` -L0 Br 00\\ -LR 0 \  -L 0RR  -L 0 ^  ^ 0  P 0 -LA0@S000 PE=(D-0  D XK-Pᵼ04> 0C6`V"#0q@v! a P0S`P04>0@#TK-DPp.Q40MU00 *@0 ?01  ` P .#41U 5:PЍm ]PDP  G- Qp M 0S pWG 0SWB 0 S  P1 0-2,0=@3P.`< 4/>$?8 <(DPQLJ<100,0!Q,"Z T 1#80S  (   0 R 0 R100 23$(, 0 y 100 23$(, 0  100 2$3(, 0  \`p@-@Q` - ,0.4/8<8 0DPR& "!"- ỻ@Tp 0Q  0 R100 23$(, 0$ p100 23$(, 0 100 23$(, 0 O-娠@ TP *0f`0 4S 0@ T:0 48| 00 0!Q "ZW\O-p DGMY  0 ` *0@ f=$0R `D0GV:Y   R U Ѝ 0 $l2 (\00,0!Q,"Z U2 $8#Ru 2 $8#R 0 48<00` 048 <SA0@ B$1C(\;00,0!Q,"Z U 048Y\p 0Sp R 0S)P 0- ,0./48<#60504 W67$0(0,0  Up P R4005  64748p 048 <S;00SZ{\p@-0 $@M (, 0 `&,0P P,C 000/S 0 $ ( ,܍pO-lJM$  p 0S/S ( 0 p0S/SJ/0@><~~<ffffff{>a`<|0f8l8vv0 000 0 0f<jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-1.1.4unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length code0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-FLASH_BASE= Evacuating 1MB of Flash to DRAM at: Map Flash virtual section to DRAM at: , Rev - [BIG_KERNEL] [MD5] [MONO]>> Last link date: Contact: bootldr@handhelds.org >> Last link date: >> Contact: bootldr@handhelds.org Cpu company: DEC Cpu Architecture: StrongArm Cpu Part: SA110 Cpu company: INTEL Cpu Part: SA1110 Cpu Part: SA1100 Cpu Architecture: XScale Cpu Part: PXA250 (Cotulla) Unknown Part: Unknown Architecture: CPU made by unknown Company: revision A0 revision B0 revision B1 revision B2 revision B4 processor ID: >> ARM Processor Rev=>> (c) 2000-2001 Compaq Computer Corporation, provided with NO WARRANTY under the terms of the GNU General Public License. >> See http://www.handhelds.org/bootldr/ for full license and sourcesPress Return to start the OS now, any other key for monitor menu Rebooting...haystack = <needle = <helpboot> quitACK0 partition -- displays the partitionsshowpartition show -- displays the partitionssavepartition save -- same as params savedeletepartition delete -- deletes a partitionpartition reset -- resets all partitions to the defaultdefinepartition define -- flags: 16 for JFFS2, 2 for bootldr, 8 for rest-of-flash base: size: end: flags: usage: partition delete part_name usage: partition define flags 16 for JFFS2 Error allocating space for name basestr is "+" bootldr sector must have flags set to 2 bootboot command failed, entering monitor Probing bank0 memory size... bank0 memory size= in megs: M MDCNFG=dram_size_ptr=Probing memory size bank= dram[0]=seems to be no dram in bank= mem_size=[i] mem_saves[i]=maybe mem_size=found= mem_size[i]= memory size=probe_ramprobe_ram -- probe for ram size and banksn_banks=dram_sizes[0]=dram_sizes[1]=&_start=boot_flags_ptr=*boot_flags_ptr=boot_flags= enabling mmu setting flashword=probing ram DRAM size probe failed! SDRAM size: jffs_init_1pass_list failed to initialize DEBUG BOOT: not evaluating params DEBUG BOOT: use `params eval' to evaluate parameters. type "?" or "help" for help. flash_typeflash_type [type] -- print available flash types or set the flash typeflash_widthflash_width [16|32] -- print available flash width or set the flash widthflash_width=32 16 Invalid width: must be 16 or 32 md5summd5sum md5sum file [partition_name]rooterror parsing base addr: error parsing size: displaydisplay display -- dumps the SA1100 registers SA1100 Registers: UART: UTCR0 0x00 UTCR1 0x04 UTCR2 0x08 UTCR3 0x0c UTDR 0x10 UTSR0 0x14 UTSR0+4 0x18 UTSR0+8 0x1c UTSR1 0x20 loadload flash -- xmodem receive to flash (see override param)usage: load flash error parsing flash_dest That is bootloader space! Use load bootldr. Operation canceled load ram usage: load ram error parsing img_dest bytes loaded to uncompressing gzipped bootldr bad unzip of gzipped bootldr Not loading invalid bootldr into flash Looks like a gzipped image, let's verify it... invalid gzip image. Sorry... img_size is too large for region: programming flash... unlocking boot sector of flash erasing ... erase error! writing flash.. addr: data: verifying ... calculated crc32 = 0xdesired crc32 = 0xerror programming flash (crc check failed) error while copying to flash! error programming flash at offset= src= flash=not checking any more locations formatting ... done. flashregionload flashregion -- upload an image to the flash. dangerousloading flash region using ymodem using xmodem download error. aborting. img_size is not a multiple of 4 -- are we sure that's OK? load [partition] -- xmodem receive to flash partitionparamsload params -- xmodem receive to flash partitionError: no partition named Here are the defined partitions is a bootldr partition: requiring a bootldr or parrot image. is a jffs2 partition: expecting .jffs2 or wince_image.gz. is a kernel partition: probably expecting a zImage. After receiving file, will automatically uncompress .gz images bootldr:programprogram could not find flash partition programming flash partition ram src = len =usage: program save Could not find partition About to xmodem send flashword= base= nbytes=download error. allsave all -- upload all of flash via xmodemsave flash -- upload flash region via xmodemusage: save flash error parsing error parsing flash_dest=flash_size=save ram -- upload dram region via xmodemusage: save ram error parsing ram_dest=ram_size=peekpeek ram -- reads 32 bitsbytepeek byte -- reads 8 bitsshortpeek short -- reads 16 bitsintpeek int -- reads 32 bitspeek flash gpiopeek gpio peek ram requires arguments! error parsing addr addr = value = pokepoke ram -- reads 32 bitspoke byte -- reads 8 bitspoke short -- reads 16 bitspoke int -- reads 32 bitspoke flash poke gpio poke ram requires arguments! error parsing value poke ram: addr= value=flash write failed! breakpoint [delayed] -- TODOdelayedPC breakpoint will be set after kernel unzip at: Setting hardware PC breakpoint at: Clearing PC breakpointqflashqflash id | security | qflash requires arguments! securityvalue = eflasheflash | [] | chipeflash requires arguments: | []|chip! erasing partition Cannot erase whole chip without setting override to 1. erasing flash chip error parsing addr: error parsing len: len=Cannot erase first sector without setting override to 1. pflashpflash 0|1 -- (1 -> protect, 0 -> unprotect all)pflash requires arguments: 0/1 (1 -> protect, 0 -> unprotect all)! error parsing protect: error protect value must be 0/1: addr= len= protect=Region specified is out of Range. Please use a range less than:callcall [a0] [a1] [a2] [a3]jumpjump [a0] [a1] [a2] [a3]usage: call [a0] [a1] [a2] [a3] last_ram_load_address is 0. error parsing vaddr Calling fcn= a0= a1= a2= a3=physaddrphysaddr -- returns physical addressphysaddr requires vaddr argument! vaddr=paddr=sectionDescriptor=invalid baud rate: Please, try: 110, 300, 1200, 2400, 4800, 9600 19200, 38400, 57600, 115200 or 230,400 update_baudrate: new baudrate= baudrate changed to 0xMMU Control word=cmdexcmdex [0|1] -- use extended commandsuse_extended_getcmd=0xAutoboot is DISABLED aux_saraux_sar -- aux serial dumpledblinkledblink [on time] [off time] [off = 0] -- blink the LEDttmode [1,0] -- go into ttmodeser_conser_con -- start a serial console sessionirda_conirda_con irda_con -- start a irda console sessionirda not available yet, starting serial console. memcpymemcpy [size]memcpy needs args: dst src num [size] bad dst param bad src param bad num param bad size param memcpy src: 0xdst: 0xnum: 0xBad size: 0x| hex_dumphex_dump [size]reset -- software resethalthalt -- power downFeature not available on this hardware. addr1=0xaddr2=0xw1=0xw2=0xmemcmpmemcmp [size]bad addr1 param bad addr2 param memcmp a1: 0xa2: 0xver -- display version infomemmem -- show info about memoryFlash memory info: SDRAM memory info: SDRAM size:SDRAM bank0: mdcnfg = 0x mdrefr = 0xmemtestmemtest -- test mem between addrsmemtest needs args: addr1 addr2 seed bad seed param bad fillval param max_mismatches exceeded, aborting. store vals cmp vals mismatch, want: 0x got: 0x addr: 0x cmp done *********num_mismatches 0xtestjffs2testjffs2 testjffs2 -- TODOread which file??? bad dst param copy the file to where??? infojffs2infojffs2 [partition_name]timeflashreadtimeflashread [partition_name]ls [partition]load file [partition] [filename] [dest] -- jffs2 read fileerror parsing clearmemclearmem [num] [dst]cmpkernelscmpkernels [dst] [src] [len]which kernel partition? bad len param enable_cachesenable_caches [dcache] [icache]bad dcache param bad icache param asmEnableCaches = out of room to build params list! + pefpef [just_show]llilli -- low level coprocessor infoARCH INFO(CPR0)=MMU Control (CPR1)=TRANSLATION TABLE BASE (CPR2)=DOMAIN ACCESS CTL (CPR3)=FAULT STATUS (CPR5)=FAULT ADDRESS (CPR6)=MMU PROC ID (CPR13)=BREAKPOINT (CPR14)=Program CounterC (PC)=catcat [partname] -- show file from partitioncat what file? readjffs2 read [partname] -- reads jffs2 file into dram at dstaddrwhat dstaddr? Reading file: from jffs2 filesystem in partition: Writing contents of file to address Number of bytes read is wrong magic: wrong arch: Not linked for flash, start_addr=Does not support this CPU, boot_caps=BSD checksum nonzero parrot word 0 ->0xExpected ->0xparrot word 0xFFC ->0xor ->0xparrot word 0x1000 ->0xExpected ->0xwince firmware 0 ->0xExpected ->0xfirmware word 0x40 ->0xfirmware word 0x1000 ->0xExpected ->0xYou must load wince BEFORE loading Parrot discoverdiscover -- guess what machine I am; see mach_type for resultno control function Machine type--> iPAQ 3800 Machine type--> JORNADA56X Machine type--> iPAQ 3100 Machine type--> iPAQ 3600 mach_type ->initialize_by_mach_type done tdztdz -- test decompress routines (best with ASCII) preflashingnot enough args, need error parsing address error parsing dAddress verify img = uncompr size = finished loading with runningCRC = 0xuncompressed length = 0xtotal_in = 0xread_crc returns = 0xcrc32 static calc= 0xErasingEnd Detected Skipping Copy of Flash 28F128J3A_1x1628F128J3A28F640J3A28F160B328F160S3No flash descriptor: reset flashprogram flash worderase flash chiperase flash sectorerase flash rangeNo flash algorithm known for CFI vendorID=the flash sector needs to be erased first! flashAddress= flashWordOffset= flashContents=programFlashWord error value= status=programFlashBlock error intelFlashEraseChip unimplemented eraseFlashSector: sectorAddress must be start of a sector! address=nsectors=eraseSector error sectorAddress= timeout=Erasing sector startAddress :limitAddress :Protecting sector ERROR - status=Protect=(1x16)startAddress :(1x16)limitAddress :ERROR - status :Flash types supported (2x16): Flash types supported (1x16): Current flash type is Flash size: UNKNOWN! Unknown flash device type: for flash organization: 2x16setting flash type=1x16 get root partition failed assetbtflash_add_partition: could not allocate memory for partition table allocated partition_table defining partition: no partition table! no partition <> found partition <> deleted QRY Flash style = verify flash size... verify flash size failed. btflash_init: found flash flashDescriptor= flashSectors= nsectors= flash_size= flash_address_mask=btflash_init: mfrid= devid=mfrid=walking flash descriptors () btflash_init: FAILED! Unknown flash type! protecting the bootldr flash_addr_shift(): bad bt_flash_organization=flash_make_val(): bad bt_flash_organization=flash_write_cmd(): bad bt_flash_organization=flash_read_val(): bad bt_flash_organization=flash_read_array(): bad bt_flash_organization=flash_write_val(): bad bt_flash_organization=Snoozing... ******** malloc out of storage ******** size=flash_iohandle_prewrite: unprotecting bootldr rc=eraseFlashRange returned rc=flash_open_iohandle: no partition named : out of memory jffs2_open_iohandlehda1:copy src dst [len] -- copy from src to dstCould not open source Could not open destination destination does not support writing. command_copy: read failed err=: write failed err=srclen=dstlen=nbytes= addr: usage: copy srcspec = | | hda1: [] xmodem_initial_timeoutxmodem_timeoutxmodem_one_nakready for xmodem download.. startingRX PACKETTIMEOUTBAD BLOCK#BAD CHKSUMDONEABORTEDWRONG BLKDownload Failed! Download Successful timeout nakgoto again:eth0 boot [partition] -- boots off the specified/default partition (see boot_type param)wincevfatbooting kernel partition base kernel_magic=no boot image in flash kernel_region_words[9]=Linux ELF flash_imgstart= size= dest=MMU Control=MMU PIDVAM=copying Linux kernel ... Skipping kernel copy by request. Copying compressed initrd from Done root_filesystem_name=Grabbed linuxargs, argc = Using mach_type pre unparse setting boot parameters to linuxEntryPoint=Booting Linux image CP15 r0=CP15 r1=CP15 r2=CP15 r3=CP15 r5=CP15 r6=CP15 r13=CP15 r14=copying NetBSD kernel ... netbsd done! Jumping to 0xF0000020.. Unrecognized kernel image boot flash [partition]kpart=cannot find kernel partition named >< booting kernel from partition > nfsroot= ip=boot wince -- boots WinCEqnxboot qnx -- boot QNX/NeutrinoBooting QNX... Found a QNX kernel @ 0xERROR: No QNX IFS found - searched from 0xboot addr
-- boots a kernel loaded in DRAMnot enough args, need
error parsing img_size ideboot ide [ide_num] [ram_num] -- read kernel from ide partition 0, ramdisk from partition 1warning, no sleeve detected. attempting pcmcia insert anyway. Reading kernel from partition number noinitrd Reading initrd from partition number Booting ide ... argv[2]= boot vfat [filename] [args...] -- boots off VFAT partition 0 (on PCMCIA if possible)Mounting vfat on partition vfat mount failed rc= Reading params from file: /boot/params boot/params Reading kernel from file: read zimage failed rc= Reading initrd from file: Booting vfat... boot boot -- boots the bootloader, againMalfunctioned Failed BadPacket End of Text End of Session Timed Out Transmission Breakdown Buffer OverflowUnknown Error totalPackets=GOT a ACK GOT a NAK Upload Successful Transfer timed out Transfer canceled by reciever ackcnt=nakcnt= Transfer canceled - Maxuim error count exceeded Transfer may not have competed Bytes Transferred=impossible condition #876 loaded file of size = 0x at location 0xramdiskflashDescriptor is NULL! throwaway_bootldr_partitionparams_eval_file: tmpPart->base =params_eval_file: tmpPart->size =/boot/paramspef: loaded a file of size failed to load params file /boot/params ... boot jffs2 [boot_file] -- read kernel from jffs2 file (see boot_file param) from partition >Attempting to output file could not find partition root part size =no kernel found partition is of type returned = no loader found for the partition invalid partition cmp failed at i =pF =*pF =pJ =*pJ =kernels match up to Verifying gzipped image verifyGZipImage: calculated CRC = 0xverifyGZipImage: read CRC = 0x1.1.4inflateInit2 failedinflate error :0xstream msg = calc crc32 is 0xread crc32 is 0xhelp [command] -- Displays help textaproposapropos -- searches for text in help descriptionsapropos Trying to load help... you can't execute the cmd <> while running from ram Don't understand command RXSTAT error: MSG/ *0x == HEX_TO_ASCII_TABLE corrupted setting param <> to value <baudrateosautoselectboot_typekernel_in_ramautoboot_kernel_partkernelforce_unzipnoeraseoverrideicache_enableddcache_enabledentryuse_initrdcopy_initrdinitrd_startinitrd_sizeinitrd_partitiondram0_sizedram1_sizedram_n_banksmemc_ctrl_reglinuxargs noinitrd root=/dev/mtdblock1 init=/linuxrc console=ttySA0mach_typekernel_partitioninitrd_filenameboot/initrdkernel_filenameboot/zImageptable_addrhostnamedomainnameipaddrgatewaynetmaskdns1dns2netcfgnfs_server_addressnfsrootverbosejffs2_sector_marker0jffs2_sector_marker1jffs2_sector_marker2conf_file/etc/bootldr.confboot_vfat_partitionrecb_cmdreflashcalb_cmdconb_cmdusb autoinitqb_cmdboot vfatstartb_cmdupb_cmdrightb_cmdleftb_cmddownb_cmdaction_cmdsuppress_splashautoboot_timeoutsplash_filenamesplash_partitionymodemymodem_gboot_flagsenable_mmuget_param: could not find parameter params_eval: prefix_in = params_eval: just_show =eval param blk found partition table in params sector pt->npartitions=partition_table_size=+evalparams eval [-n] -- shows the parameters-nparams -- displays the parametersparams reset -- sets the parameters to default valuessetting params to default values flashword = bootldr_params = FLASH_BASE = sizeof(bootldr_params) = set =show params show -- show parameters= <=<=<0xparams save [-n] -- write params to partition, if existsflashword=0x&__params_begin=0xFLASH_BASE=0xdefaultParam=0xbootldr: set "Not erasing and writing params sector. No params partition found. I cannot save params into Wince or JFFS2 files!!! placeholderrecbcalbconbqbstartbupbrightbleftbdownbactionAuxm checksum error, csum: 0xmsg byte: 0xBad state in auxm_process_char, 0xauxm rx status: 0xTimeout on write, stat reg:Initializing aux micro this machine has no auxm console char read, exiting 31003600h3800_control_egpio: error - should not be called 3800h3xxx genericgpio_init: unhandled mach_type=h3100h3600reflashing not enabled. Reboot with action button depressed. Embedded Reflash UtilityScanning for images...No PCMCIA card foundvfat_mount_partition returned VFAT mount failedreflash.ctlCan't read control fileSelect image file to load:image name ; image ; md5sum ; target total images button k=Select image file to save:selected image is Saving file...No feedback yet.Loading file...Cannot read md5sum frommd5sum file is corrupthave md5sum for md5sum not found in fileCannot read image fromChecking md5sum...Checking bootldr validityFailed to gunzip bootldr imageInvalid bootldr into flashChecking data integrityError in compressed dataappears to be intact.Press RECORD to flashor any other key to resetCould not open Erasing...Programming...Verifying...Done nbytes verify_crc orig_crc Programmmed successfullyErase failedzerror Decompression errorWrite failure, err=p1 = p2 = *p1 = *p2 = Verify failureImage file is corruptPress action button torestart the systemr = %d bootldrreflash invoke reflash utilityDisabling LCD controller Enabling LCD controller before EN after EN after EGPIO DBAR1=LCCR0=LCCR1=LCCR2=LCCR3=params=0xsetup def img setup mono4 palette pal doneimg done illegal params_id: 0xlcd_ddefault_init: params is NULL lcd_display_bitmap: params is NULL fb: 0xbufp: 0xsplash() splash: uncompress failed, rc: 0xsplash: uncompress failed, uncomplen: 0xlcdonlcdon -- turn lcd onlcdofflcdoff -- turn lcd offlcdlightlcdlight [level=0] -- adjust lcd backlightlcdfilllcdfill [inc] -- fill lcd displayNeed args: color [inc] lcdbarlcdbar [percent] -- fill lcd barNeed args: color [percent] Need args: start_row start_col end_row end_col percent direction color percent: 1 .. 100, direction: 0 - horizontal, 1 - vertical Need args: start_row start_col end_row end_col color Need args: start_row start_col end_row end_col lcdinvertregionlcdinvertregion inflateInit failedmemcpy 0xreset obuf inflate failedinflateEnd failedabout to display lcdzimglcdzimg -- display gzipped imageneed args: len img too big, zbuf size: modem_rx returned, rc: 0xdownload failed. Aborting lcdzfilelcdzfile [filename] [partition] -- displays a gzipped PNM/boot/splashz_linuxbad splash load for file: splashsplash -- display the splash screen (also see lcdzfile)lcd fb max = P6this is a ppm file P5this is a pgm file unknown file type, exiting... bad height bad width loading pbm from location: of size: fb at location: error reading pbm header width :height :maxVal :data :use_ptableuse_mtd_cmdlinerootfstypemdcnfg=mtdparts=ipaq:,@0x(ro rootfstype=Making core tag at Making cmdline tag at Making mem32 tag at Making initrd tag at initrd.start= initrd.size=command line is: hal_ops=detectopt detect=usage: hal init hal detect halhal init -- initialize hardware abstraction layerhal detect -- detects hardware abstraction layerUnable to generate CRC16 lookup table Receive buffer too small () to accept file size Sender exceeded size of receive buffer: Error during YMODEM-g receive, giving up. ready for YMODEM transfer... Too many errors during receive; giving up. h3600_sleeve_init_module h3600_sleeve_init_module: malloc failed h3600_sleeve_insert: no spi read, defaulting sleeve vendor h3600_sleeve_insert: matched driver h3600_sleeve_insert: no spi read, defaulting sleeve deviceid sleeve vendorid= sleeve deviceid=registering sleeve driver BackpaqSysctlGenControl=BackpaqSysctlFPGAControl=BackpaqSysctlFPGAStatus= busy: status= pbuf= pbuf=bytes_written=busy_count=sleevesleeve detect -- detects h3600 sleeveinsertsleeve insert -- detects and enables h3600 sleeveejectsleeve eject -- disables h3600 sleevesleeve on -- enables OPT_ON, does not attach driversleeve reset -- asserts OPT_RESET for 200msfpgasleeve fpga -- load fpga from dramsleeve detect=usage: sleeve detect | insert | eject dual pcmciadual_pcmcia_probe_sleeve dual_pcmcia_remove_sleeve Compaq Dual PC Card Sleevesingle cfcf_probe_sleeve cf_remove_sleeve Compaq Compact Flash Sleevesingle pcmciapcmcia_probe_sleeve probing for dual pcmcia sleeve dual_pcmcia_linkup[0]->prc=pcmcia_remove_sleeve Compaq PC Card Sleeveh3600_generic_pcmcia_init_module: registering sleeve drivers h3600_generic_pcmcia_exit_module: unregistering sleeve drivers generic opspcmcia_init_module pcmcia_register_ops: ops=end cis mapping=cis[0] = manfid[0]= manfid[1]= funcid= fixed disk pcmciapcmcia detect -- detect presence of pcmcia/cf cardscispcmcia cis [slotno] -- show card information services (CIS) data pcmcia insert [slotno] -- enable and bind driver to card(s)pcmcia eject [slotno] -- disable card(s)pcmcia detect= type= len=ide_use_packetide_use_chs identify command= ide status= serial_number: firmware_revision: model_number: n_sectors_user_addressable= bytes_per_sector= major_version= minor_version= flags= bytes_per_track= n_sectors_per_track= n_cylinders= n_heads= cmdset[0]= cmdset[1]= cmdset[2]= cmdset[3]= cmdset[4]= cmdset[5]= ACTUAL bytes_per_sector= start_cylinder= start_head= start_sector= sector_count=ide read: status reg=ide read: error reg=ide command failed with status= error reg= cyl high reg= cyl low reg=ptable signature=did not find dos partition table signature reading partition buf= n_sectors = n_bytes = reading n_sectors ide write: status reg=ide write: error reg=write partition identifyide identify -- reads and prints disk identification/configuration informationattachide attach -- attaches ide drive at ioaddr -- not needed normallyide ptable -- reads and prints the dos partition tableide read -- reads from disk to dramread_sectoride read_sector -- reads one sector to dramread_partitionide read_partition [nbytes] -- reads from partition to dram. partno starts at 0.writeide write -- writes to disk from dramwrite_sectoride write_sector -- writes one sector from dramwrite_partitionide write_partition [nbytes] -- writes to partition from dram. partno starts at 0.debugide debug -- toggle ide debug (very verbose) modeide verbose -- toggle ide verbose mode8bitide 8bit -- read/write sector buffer one byte at a time16bitide 16bit -- read/write sector buffer two bytes at a timeattaching ide drive at ioport=ide_debug = ide_verbose = ide_sector_buffer_stride=sectors_per_cluster=0 bytes_per_sector=0 -- bpb_info invalid Invalid long filename entry: ordinal < 0 Invalid long filename entry: filename too long vfat_read_clusters called with nbytes=0 vfat_read_clusters_offset: offset is not in this cluster: offset=vfat_read_clusters_offset: offset is not at beginning of sector: offset=Reading cluster = Reading sector = Placing at = vfat_read_clusters_offset: reached VFAT_EOC at bytes_read=Freeing cluster Destroying currently allocated chain... Not enough free space on device. Allocating cluster vfat_write_clusters_offset offset = vfat_write_clusters_offset: offset is not in this cluster: offset=vfat_write_clusters_offset: offset is not at beginning of sector: offset=Writing cluster = Writing sector = bytes_written = vfat_find_dir_entry: fname='' dirname=' basename=' searching root_dir_entries vfat_find_dir_entry: find_file_in_dir: vfat_find_file_entry: fname=' dirname=' basename='vfat_find_file_entry: got dir entry for attr= clusterno= n_bytes= looking for file entry in root_dir_entries: vfat_find_file_entry succeeded: Could not find file. attr= first_cluster= n_bytes= vfat_list_dir_entries: attr=vfat mount: reading bpb_info oemname= sectors_per_cluster= n_reserved_sectors= n_root_entries= root_dir_sectors= first_root_dir_sector= fat_size= fat_size_bytes= n_fats= total_sectors= n_data_sectors= first_data_sector= n_clusters= fat_type=fat: first data: mountvfat mount [partition] -- fat partition on IDE partitionmmalloc failed cmd vfat mount: partid=get_ide_partition_iohandle failed vfat_mount failed with rc=cmd vfat mount: listing the root directory vfat ls [dir] -- lists directory contents on mounted vfat systemvfat ls: rc=vfat ls: entry.n_bytes=no vfat mounted next_clustervfat next_cluster [clusterno] -- computes next clusterno from vfatclusterno=nextcluster=read_clustervfat read_cluster vfat read_cluster vfat debug [level] -- toggle/set debug verbosityvfat_debug = vfat_file_open: file not found errno=Reading in parent entries... Cannot find file. vfat read [bytes]bytes read=vfat read [bytes] vfat write [bytes]bytes written=vfat write_file [bytes] set_filesizevfat set_filesize -- resets file size is a directory. could not be found. error = usbusb init -- starts usbusb status -- does a status check on USBserconusb sercon -- switches back to serial consoledeinitusb deinit -- sets usb_initted to 0loopusb loop -- does a 10sec poll loopversionusb version -- prints USB codebase versionspit4usb spit4 -- spits 4 letters outspit8usb spit8 -- spits 8 letters outspit12usb spit12 -- spits 12 letters outspit16usb spit16 -- spits 16 letters outspit20usb spit20 -- spits 20 letters outconsoleusb console -- switches to console on USB.usb autoinit -- auto-inits USBversion 1.0rc1 aaaaaaaaaaaaaaaaaaaaPlease disconnect serial and connect USB to the device. After doing so, launch a console on /dev/usb/tts/0 andinput a character. Now switching to console on USB... Now switching to console on USB... success!! Console is now over serial. WARNING: previous failure initting USB. things may fail again this time due to a weird state. eeps! usb already initted! things might be in a bad state, so we won't do it again, kk? interrupts must be enabled. failed to initialize interrupts timeout disabling UDC timeout enabling UDC timeout clearing 1 timeout clearing 2 timeout unmasking interrupts Couldn't set Ser0UDCOMPusb successfully enabled USB not initialized! run usbinit first! previous failure initting USB. run usbinit again to try again. doing a single poll. Ser0UDCSR: reset interrupt request resume interrupt request suspend interrupt request transmit interrupt request recv interrupt request ep0 interrupt request still sending something else!timed out waiting for send completeproceeding anywaycount == 0??MASSIVE ATTACK failed :(MASSIVE ATTACK worked :)ignored interrupthmm, TIR, but not sendbusy >.<Too late, underrunTPETPC failuretimeout flipping tx statusRFSRPE.timeout flipping rx statuseek, couldn't clear rpc!SST.Code: Whisky Tango Foxtrot (could not clear SST)FST. We didn't set this, who did?timeout blocking on IPR next reset state errortimeout flipping statustimeout clearing resetLUSB: LoopingU_USB: Done done next state is error!couldn't set resimcouldn't set susimsent stallEarly term of setupno OUT packet avail. exitingfifo READ ERROR, not enough bytes, Stalling out...PocketPC init sequence detected - starting DMA herekEvAddressSET_CONFIGURATIONbad time to config!kEvDeConfig errorsetup phase: unknown setconfig dataCLEAR_FEATclear feature ep halt on recvrclear feature ep halt on xmitrclear feature ep halt on bad epunsupported clearfeatureSET_FEATset feature ep halt on recvrset feature ep halt on bad epbad setfeatureGET_STATUSunknown ep in getstatunknown tgt in GETSTATGET_DESCRGET_CONFIGgetint not supportedsetint not supportedtimeout setting 2 unknown requestquitting setde b/c SST/SE setcan't set de (MEEP)can't set ipr (MEEP)quitting setiprde b/c SST/SEcan't set iprde (MEEP)clear_opr() failed ASSERTION FAIL, fifo_count > 8read_fifo: read failure :(write_fifo: write failure!the UDC most likely locked up. sorry.so didn't clear oprcheckz0r, 0 bytes leftqueue_and_start_write donesh_write(): IPR set, exitingsh_write empty() Sent empty packet write fifowrote fifoDESC_DEVICEDESC_CONFIGzerovendprodNULLunknown string indexIFEPunknown ep index, stall unknown desctype, stall wanted bytes we didn't haveint init -- starts interruptsint version -- does a interrupt version checkreadcpsrint readcpsr -- read cpsrversion 0.3sa Interrupts are already running. Not reenabling. enabling interrupts: handler, stack, irq, unmask, CPSR: dmadma init -- starts dmapolldma poll -- polls once on DMAdma version -- does a dma version checkversion 0.9 DMA from buffer A is done! *ding!*DMA from buffer B is done, but there is no buffer B. *poof!*DMA error! *wh00nk*yes, it's running.no, it's not running.dma-sa1100.c: dma_startsend: timed out waiting for DCSR_RUN to become 0.outDivision by zero! cramfsCRC Error!4 offset cnt = node offset cnt = obsolete cnt = add_node: malloc failed UNKOWN COMPRESSION METHOD = find_inode failed for name=Scanning all of flash for your JFFS2 convenience. Est Time: 6-12 seconds! build_list: max = dir entries = frag entries = +4 increments = +file_offset increments = add_node failed! Offset = Failed to scan jffs2 file structure Failed to find inode Failed to resolve inode file structure Failed to read inode Compr = NONE: frag count: compressed sum: uncompressed sum: Compr = ZERO: Compr = RTIME: Compr = RUBINMIPS: Compr = COPY: Compr = DYNRUBIN: Compr = ZLIB: zImaged\B@p\BLBBØ\B\B\B\B\B\BävB\B\BÐHCTB]B(]B@]Bh]B|]BÜ]Bð]B]B]B]B ^B,^B<^BT^Bt^BÄ^BÔ^Bä^Bô^B^B^B^Bl_Bô_B@ @_BàB|CäB{CTB|C@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|@@  "$(*,.02468:<>@  "$&(*,.02468:<>@>>>?@???@x}tי6Fi4~gnv79-Φ% t0aFa$8Z﫫$9bi"W&,F$D=3jb/~OHg0 2 2 TWs BW@;0P* !KKj]GEL+3RG>LgEL>*p օ&Jֺpeh{`x('m'C.{J\p-MaZ]aØӨ T5]R8R%<|TaM&qdqtR j#ĘL~ʂ5` %3LRjAHPi RRA;8(!j1hjWa+7ٙNoBMHs.f: ȅtD(uxG>Wg:PK%3L8y\@1qĝ*dp\%`_? I#L1H+!*bV$#@q(: #6e$@K[zk9ս^`rHU|_,Ԩ@FAj]R5N`r)8$]H!g؀iH8E1IM5_e^}+gr>pAh4Ef9D^HdHyNFVRXР⃤Vwgo+}`Uo^?QXngp%ǞNė8L*/IxMALȱg2!Ek2u[qQ9#ZLS n/;^q*HޡH҉M2HL&5|67`K<&(Е%>(΀G*[$)QH霯rn+k|V3+ Q=r*CWHt Nc;cgI=#vT=RU* =MOsiWϟhy-2F?I{;2;\k D'5&AH=Q#KN@ xmE"V}_xik }HK](#uPGmEh &iM:lu ASe@saoXoiEYږoM޹//k7rݙw7hzF-[p!B`LofS%HvNʹAkCc<]&җǑgi'gŸ܆𬈯y=^/yiFAdAdAdAdAN+?{~ EY_Eg/u/޹paGTčkPf>_WvwTZ޴v⟮g̱~?]nZmZViw~Ph6PhPZ~smvo.Sݎ ?zi,- u/>T[l'^=PL;"XO#cgnojfn޳mGWV5UfݱWw,@vt{|0hAЛVS*2m۱tRv9LuǪx狱+}CP)NS[+ۻ:?g;uk]\~vʲⶬ]4۝wse+߼ʲqaZmCmjE=El]gZ8:ҲU $lmR]ہ/"W)DZ } :{N%==_OeO>yQ׃>S%񣚳:[U;_Y*G<{䘊Ƣ];W12e摓A/~GZΩ(!t%걝SQy4g'Fj6mi/:* /V8JpD梄t>qywacCo&1>0!hkIbb*[U[xiٚ.7Lâ{[gVR:TW KOgC5_Z*{z2_+T- S7߼c.5\cO?F+fuV:xPyW7zztcky[2 QK*=g95-?_xܾӒH;|~2 |KWc86F6hh$N|=ai ]ի,zJ'Wg(U k--Uu'T8~Xh *TL ,ll{۲6Y-#lMF`QOe[Ak9b8L&V_j:S5B4 Jb} #i`~dօQbVg~k;2w򣏝:GVȱvHoAh`:"pTW[뻝WF?NgL_ [}b˨`c]kU>ow޼k(#+=rtҦrIߖm WO=9Y4ɾ/G$ֺ W>p윊QZg~6`UF?v+}ʩyg~_VlUhCo/ ?Ԫ߶?)ci+cB_  zzov7?h uUҶ:S=r@E]`m8oFFՎ2+bG`0 P]gߙ3YګbOʶWG(uΟչmlloi-"S m ##聑_Ep8x(Ƌ*^=iKsl Y F=َUm#4u~RWj #*llf]1JW3}BrU巶߶c=֪Zg]Fp:Bc@~K|lP0m益 i쩄qtZS|3v<سN+JdL}*NN_湖Aۛ__WOQkjt[fubxU\PƾNko ۃ_ tKDG~ӆӶ?{6;g_LJKʪtY??עX ㌄R&sy^+OSXTv-< -We) ш M E}ln\^ѺHiVUBnolgllS-\n=V( UYG~o,QE}Y}{t6{~%u,1_ׂٶo{H+ [RW'ֺ 0k.y@ɄȚľG:0N5L-'ͭ׫MW,* Za/Aܽ^8X<_B_xx޾* ;H:2 kMv-wO{F쓐^o)DŽ|"SF _UxA#Ϩ8z1rU`qQ~= (=pOm j* V$fDk]3lx[&5Æzj3lcj]hrp+HC1do` MUyf=lտi i_DbV+iRۚq\u ~q|t@_FX4FPkOox6Di@L [8!8oRoX6!*qO܁h{O}\[UD5Tdnlh.]~݋VT\'ڱ'SUu9 ViK},w3"fqj<(M>#n8kS*shEۚo^[["D<;s^Dze~Q]Q-rm00LYR27ׇnznyEn6ЎiG8JkQzw8ỏn.32p=G%;z蒦@okEfn+gP/^?2ˏ)7w[x=rzu(C?/wk8=sË́?⾿n5$QfrNS7,_E_3W8] b As4K)8C H5ng_B}^3vjD~l5Vh'j Mcjbv/%-Z\d^ކO+6P%҆|6Qrs|_]`3^L_<pZ83.\Ia*R+̓QBz̀jD~f1O2"-P?i.@y?uO}Y+19KνX?kMO7ܴ>ky׆w] ot9=|4G^38?= mʯ>rW,W'MW#t+q4%`yGrKyfE>'gmR-M?]96o .ljȔԈ%`yט2&zc?} 披`!q3jkIMӖ pf=DZԕJ q?s4R5Ms6=6{Z qY~O~o I)7 41Yh3AeީMaCX']Zq A9q@[_3lqё6,[o֦G-9lcc=7gvbT!/f(SU\1``P>"ikH/Z#"f:!{Rr/NH1 # IF5* h6Ի0a[T|u,KV5}|e5c\s幧H6&[??ѧDTava-SJ[EN@|z֨'F/ )8*5j|0&ۊݾڃv=^=] m 4o ˆLg*3Iю7Gc xvn&}DHS?9tuNKM+]]*bC㯺ೡ ;*uG=?o/ƆA#jpseC52T⏢e/\q|8ܯ 0 #-g/v~ZHί?MO6x=O\-mL.ţLJhk>P'*F!fNZ5s&Y];.q~ݿ{s/K=sMνzʕ zϫK42:.2kV'=11qaxi*Jwm"sj{o]ι6O{{_eC5GQ{Ga\2Z"zĴ:/v~K|[أyOv4bQsE3!"Wcr9aON3\tXnA:e^aC!Nly5Џ1 k*b躜sˉ%r|D>u`TmwPWKד룧69. KIco7Sc B/I͋5r"[#ƀS9]s>\7*bۥzWB}4>HBgД_ImNԂ~Q;)E=i< 2ƨ~g.26.LgS=} 軔D`<С@Y\偽i21JGrDqv8/@,Sw(QҶ9ȿN]9X9GYp"#GPQdj~4ґ;sZ$qnbeL4nPT~[g'Guts=ڳGW:!/PSvT=t(b&Z?!/u@̶mU9_bf98<b 𻃖ۅS>e<,;nU[Omr*MFl ު-^A w(|xb{Ttޜ8F K D5,Syцqo{\D'7/ű,tJwuڕmծ{7˦bП>̺LS(ktNj9xÁo{p \_Yx/?ЁrdYOM}΅;On \HΉwu\T]>h_'ԇ/4=ۺo,jRA|7}z/p:!_'.H_F8֫sy}oK/~ε%Ww&zlQZ#3#Ϻ{>X`Os`+op{_λu}).Gٚ8.cGLGV5w?jִͥrM~^Tx7>(ox(Jl+'19_vF,E4EEʞTK_(moߣr;\(r;@wlJ:}:i'[Ԡ|o_fqQ- ?^%GBmji5)/]sq;x:th]1&vkEOg= ͼu*N.#5\}Q-@9S}|TEgԞ >OPreǡSoþ[\Oh'&`DV*^챸i-߼cU_[Whol_ֲeo+*4h9`նcUv}b&e%{v0V^q+GtVP}EFNP{(zXpnbbK x_y_O}1Ca3 bMU/ S.ږ{=ϋû23mr+xP{/~ j_?VDkw5RN%K_OW7/OSSʯSeB4yZ;,cVh?{Lc9uW;/TksZzZZwWW#/?/Fo?;X%zI}B^(jw8*ߋ[iV{|2>QVĀhG /w8 y|;ky 껲%,\ޏ|PRжezsV:/?Uwow_ؓL~kѶc9S?C9j'URdפ /aRw (2V>Q D]ГSuPc:ܒYxԃKjaѢ0*fRg]9,S5$c$Mo=з&72a#v !usEfOE*Ok۳6=vJGޮx'-\R^ 2IU8|$bB%\RGsLR 7^2V_WP4K.幤0X gdO>+*ߏ7Ew&8Gg"%^>Ujm mI/sU٪?F u(s\gH`߿5Hvv VĦuHH̾a -QZ'dլl z\DmaV >>PE$+b%9׃}ybh [7v6E_.`;B#47T ^tom<ɛRDK_~U|_`;EO?mW}Rm[Y'.}Uz{"з eÞ'(۰'ե!=þϹ9 %oU5yd9ϵ"y\R#U##׻( þ>7P_%Pu(?phcp2pKW|< wZߣ1܍xS =HK;$즦cKϼt=v/>҅[6o{&lX>u-qԎhC=X J cfeղ+<:8(?h6ckr5᳹#oš~*9mSl# Vd&mEXd?j' ˎ~\ i2:}N^w,ߴɅ'mNxk[jUS?#WKE q P) V Cfu[iPH=T+$-B}NmPij'VRyhYhiFV)a>1 =>\wiȗ䄾%5L%)&E0 U)59xGYS?ky܎@h}. +-{|OPMK6}6gcEp` |IOڻğ??_E ϱO[߄_`LwmN>p)Jd0^ʡ}`Eާ"mSˑdT3!J?X Ӛn+iUGx١]Oa1Y'ٷ ikşd bnNKNb6;Tm-,Y sE%"_grƸx0yQDœហLQҮ]RJz#6rob+"iR#VQ"_hA8W4~DmǏoCJ`!vN\(wK?9LUݻ("Tvg /\%;-o_"!2pꨍLOl[}P;OfzLF/ZO+-s*$륕^pk {ee{o*ciL_GعBrs\vΛ2[Ooq[!Qw(./u[ ܜ^="՝#lOҎItׯiۅ4l VS|to玩Ee@d*Y]Nxǻ*4φz¨]jk-+TK|&N߰uo ۣv:[|y8d=x^tnPQwЏ9å ;-ƛ>#ͣ1?vV[d|ӭWS.e@_aů2(D ֛^/֛ Nxڗ^siR_a]NWr%T``Ms[m7.zgflkfriȤ>ɦۉ踽b3ףRg i mgߴgޫm-2 v` d1idQdDyGCUc/g&_Fz6yz [ei1_kh{i]{ܾ h3O͈3|L'}khi9ldobI!wߴ{0VPܜakƓdN̒N~v3΢Zf[&('zw[K|H[du\H ezu<$o#U! EnpJpюrg* Zsj j>{4 Fq-f[ީm$@kH$Az0E @7̥VQ %}NӭҌ KVUCn&# H&H+耔FֆQ_i /ݭ)3F 2- f>.si*Ssz|^%-ڍ~{IƎ L5V⁃NjF_a.R<7Ӊ071_$OHSA4D~Ҽ0p%9rE- m~|^+a hBO/fhs|l!?4G R s^Ns!-5,Q* M'qe0kRsi%FOk8iAi n sse.{+$oYT!3UytUFikseGyɞAQ+Q$\7PK}Z6qpDl[13+dh(5/>zh 5꡹a_gĺHe!z^5V_$!4 rpͬ8h#XDL&aDİ-.ëL8_)iG8/R 2Uc5}[¾8FhQ-rh;#?z-xTC'Cx'ZL.${L%AK}\w*VCR?|r$Jp_ 1%)] CcvR{"zxc![G7x "E9Ua8>XZVD OAf(\V aTqD=dh)},>OWukqs+E!]T79xc>z%U }lhg/#B?~-\& iW֎rN-Uxgy2ߧ>VeuoK}$OY+e>6BvwIyvۉ^Qa)03a+7i/   M̜ rMQ#ԫY=oq$R*ڼ<&B ѯɔW 0N(Nm:!yk}Ӥ }#"}HMYl^/kxrE&2 πDwԲ<^;O% eaߊtuF<%;i7 WcNG$RWyI .wy|KL[tc?yO$,ٴ3"D ̓?Ď^ԲBSi$:$}+duVdMi۱Akר=yZVxBr>oyD2 ' yWjZ+dֺO|S5F^/vD!q2}Y"l̀}Xַ J>Z<,r]d ]B5k!jK>=FAdAdAtEHS7ub}>Jwe<ɱ3CCOo[;cdq)ڹ ;blS3%:)ys  X˻.^_C _!vo(7x0DӉcx? ǜOw}x;x19-- n(C|8(a P-$9ǻ񇝚P?c'gtG`#u}\%&Ld(zHC?D䧮k+vN]ŨÑ I pkׯ!Ҧ[콖䥕wGLݟO,/t1{#g-TծI.Oԛtx\oHz=Hz'#V x 6"y_LҮzdkG?E!Y֞RNOX㖙QKZΓPMVk<1GȘXk%#keR)_ Wg@R-_l}9>-4wOe}z-=!Lܙd㮥w}~/dğ[ Z H ۝T%#o5p͖a=3Vhƻkhw`7y^LfCwtgp?\'`槦ݫ_|k'{DD&dDz2O/G>1~ 8 Q;y0x~y<$n_5nqwl("-vyNn#ED!ML-OVƦCOR1N?-nH_Lim5~ң=64=hA߼(iH_ L b=K_*t8ֱDwdR h"EkpX;,YVW"n7m=mX [9' bx.L!n26_oE7~W.Eg6$=H?mVp#FŝgFg}QP]d(dAdAdAdAdt.vA%%%"handhelds.org"handhelds.org opensource bootldrMon Apr 28 20:53:29 BST 2003 `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??     `@p@À@@@@,@@@aC`C`C0   0@ C0e( @ C0   0 CZCZCZCTBcAcA$[CA(AAØAAAAAA,A$AALMp@@t@øu@w@@w@x@P|@؇BÉ[CÀBbootldrrootp@Ôq@pt@w@@w@x@y@BÉ$\CÀBbootldrrootBÉ$\C@BbootldrrootBÉ$\C%Bbootldrroot Bð$\C'lBbootldrparams@\Cð\C ]CÐ]C[Cx@Ì@@ؕ@ð@@Ø@@ZCÐBBB@>B>B,@>B>BĦB̦BԦB,ܦB ħB0A4A̧BXAÌABðA ABKAKAKAÄBT_Aô_AȹBFC_AÐ`ABBFC`AdaA4BBFCaAðbAzAzA${ALAB B BTB` BtBFBGBøB\BtB BBE@ìBBBtBȟB؟BBBB BBG@(BF@8B@BLBXBhBtBB B B B B̠BBBfB(B8BDBTB`BBBlBxBBBBBBBBȡBСByB H@ءB B B B,B@BTB`BhBxzBtBBBBBbBBBĢBТBܢBBB G@ BB0B8BDBPBBBBtBB$BlB@D`BlBl`Bü@t`BlBà`B@è`BlB`Bð@`BlBdB@aBlBLaB@TaBdB #@ dBeB(@øeBfB (@ fBfB)@äfBfB`B)@fB4gB*@@htBtB\?@tB vBDA@vBDwBB@LwBlwBB@twB(xBD@4xByBTG@ÔyByB8H@yBzBDH@zBpzB0I@XzBxzBI@ÀzBzBI@øzB {BJ@({B{B`N@{BdBO@|B(|BO@0|B|BxP@à|BظBS@}B$}BS@(}B}BT@ü}B~BW@~BpBW@|BBW@èB`BDX@BDhB`BôX@B4BY@@BXBpZ@dBBx[@ȀBPBH_@TBdBt_@hBhB``@lBtBôB4a@üBLBf@XBTBh@XBB$@BbB@XBbBHBÔ@8BbBìBt@øBbBԕBԭ@ؕBbB,xBȮ@PBbBԖB`@ؖBbBôB@BbBbB0@BbBtB@B$`Bp@DBlB@tBlB,B@4BlBd@dBlBdBp@ÈB$|Bd@4Bl`B@HBlBl`B@PBlBà`B@ÀB`BAðBxBh*AÀBBt*AàBB*AĮBB*AB@Bd+AHBB.AÜB@BH0AHBܱBX1ABTB2A\BдBÈBÐLAԴBдBÔBÐLAB BÔB]AB B